PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_000882-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 272aa    MW: 31345.1 Da    PI: 7.8467
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_000882-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.8e-12872148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.................TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.................kgRtlkqcksrwqkyl 48
                     +g+WT++Ed++lv+ v ++G ++W+ Ia+                    ++Rt+k+c++rw +yl
  AHYPO_000882-RA  8 KGPWTEQEDLQLVCFVGLFGDRRWDFIAKVSEwgtltrsihfnqsflvgLKRTGKSCRLRWVNYL 72
                     79********************9999999999999999999**********************97 PP

2Myb_DNA-binding55.61.2e-1778123148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++l ++++ q+G++ W++Iar+++ gRt++++k++w++++
  AHYPO_000882-RA  78 RGKMTPHEEKLVLELHSQWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 123
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.004372IPR017930Myb domain
SuperFamilySSF466891.83E-256119IPR009057Homeodomain-like
SMARTSM007177.4E-12774IPR001005SANT/Myb domain
PfamPF002498.9E-12872IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-17979IPR009057Homeodomain-like
CDDcd001671.28E-71072No hitNo description
PROSITE profilePS5129425.61673127IPR017930Myb domain
SMARTSM007171.9E-1677125IPR001005SANT/Myb domain
PfamPF002492.8E-1578122IPR001005SANT/Myb domain
CDDcd001674.00E-1180123No hitNo description
Gene3DG3DSA:1.10.10.608.7E-2480126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MVQEEIRKGP WTEQEDLQLV CFVGLFGDRR WDFIAKVSEW GTLTRSIHFN QSFLVGLKRT  60
GKSCRLRWVN YLHPGLKRGK MTPHEEKLVL ELHSQWGNRW SRIARRLPGR TDNEIKNYWR  120
THMRKKAQEK KRETYPSSSS SSSTSDSSSS SNNQAVNSKA ANETTESFDS TIATDMSTLQ  180
GNKYQKSQGK GEEVYSMDDI WKDITSEEPI KPVCDVYREG SNFTCPPLAS PLWEYCPDAL  240
WRMEGDESKM FFSSNDQFVP CYHHENMSLT G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2551271105MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-25112751159MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-25112751159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685834.11e-135PREDICTED: transcription factor MYB59
SwissprotQ9LX824e-87MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0K9QEZ61e-125A0A0K9QEZ6_SPIOL; Uncharacterized protein
STRINGVIT_06s0004g04140.t011e-108(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.12e-86myb domain protein 48